PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT26627
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 350aa    MW: 38952.8 Da    PI: 4.6327
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT26627genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM85.31.2e-26481871128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkk....lelee...vikev.diykvePwdLpkkvkaeekewyfFskrdkkyatgkrknra.........tksgyWk 84 
               lp G++F+Ptd el+  +L+ k+ +      +  ++   +i+ + +i++++P++Lp  vk +    +fF+k  ++y  g+rk+r+          ++ +W+
  EMT26627  48 LPIGVKFDPTDLELL-GHLEGKIGRAVshvlI--DDfipTIEMAeGICYTHPENLP-GVKLDGIASHFFHKICNAYDVGTRKRRKisnsdynvcDEHLRWH 144
               699************.88****9998854432..232223555557**********.566677899******************756777666544778** PP

       NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
               +tgk++++l+++g  +g kk++v+ kg  + +ekt+W+mh+y+l
  EMT26627 145 KTGKSRHILDNNGDIKGWKKIMVLRKGGYK-AEKTNWTMHQYHL 187
               ************************987665.58*********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.15E-3133206IPR003441NAC domain
PROSITE profilePS5100527.60948206IPR003441NAC domain
PfamPF023652.8E-1149187IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MEEPFIVTGK IIATMIRNGE LVPEAEMECP NCEHRIDNCD VSSQWPGLPI GVKFDPTDLE  60
LLGHLEGKIG RAVSHVLIDD FIPTIEMAEG ICYTHPENLP GVKLDGIASH FFHKICNAYD  120
VGTRKRRKIS NSDYNVCDEH LRWHKTGKSR HILDNNGDIK GWKKIMVLRK GGYKAEKTNW  180
TMHQYHLGVD ENEKDGELVV CKVFFQLPSE KAGQCVMFAV DEESDSFAVK IDPTTPMTYP  240
PQPCRPNGSP FETGQNQEEE EFRLSAVRGA AEWLAGTSSH AIDDVALPDL DEHPSRGGTP  300
DAAYPEKQHL PLVDTDTLQG CPDAGTPPDF SSLADLPIGS LDSFNWLDQE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3577630.0AK357763.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1061G08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581357.21e-121PREDICTED: NAC domain-containing protein 8-like
SwissprotQ6NQK23e-67NAC8_ARATH; NAC domain-containing protein 8
TrEMBLM8CHC10.0M8CHC1_AEGTA; NAC domain-containing protein 8
STRINGMLOC_11732.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21103799
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25580.12e-68NAC family protein